PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.010G186100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 473aa    MW: 52361.3 Da    PI: 4.6395
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.010G186100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.12e-1861108148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                           +g+WT++Ed++l+ +v+ +G g+W+++ r  g++R++k+c++rw ++l
  Sobic.010G186100.1.p  61 KGPWTPDEDKRLKTYVEAHGEGNWNKVQRNAGLNRCGKSCRLRWANHL 108
                           79******************************************9986 PP

2Myb_DNA-binding41.82.5e-13114157146
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                           +g++ +eE +++++ + ++G++ W++ a++++ gRt++++k++w++
  Sobic.010G186100.1.p 114 KGPFDAEEVDKIIRFHIMWGNK-WAKMASHLP-GRTDNEIKNYWNT 157
                           799*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.95256112IPR017930Myb domain
SuperFamilySSF466894.87E-2958155IPR009057Homeodomain-like
SMARTSM007171.8E-1560110IPR001005SANT/Myb domain
PfamPF002499.7E-1761108IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-2362115IPR009057Homeodomain-like
CDDcd001674.01E-1263108No hitNo description
SMARTSM007171.1E-14113161IPR001005SANT/Myb domain
PROSITE profilePS5129418.298113163IPR017930Myb domain
PfamPF002492.7E-12114157IPR001005SANT/Myb domain
CDDcd001672.89E-10116159No hitNo description
Gene3DG3DSA:1.10.10.605.1E-23116162IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 473 aa     Download sequence    Send to blast
MTVVKVEEVA KADENPALVG GLDDEAETGY VSPDDDEDDE TDSDGDYEIP SGGDGVPELR  60
KGPWTPDEDK RLKTYVEAHG EGNWNKVQRN AGLNRCGKSC RLRWANHLRP DLKKGPFDAE  120
EVDKIIRFHI MWGNKWAKMA SHLPGRTDNE IKNYWNTRLK RNQRHGLPMY PEYMLSQVMH  180
PHQDMNCETP GESPGKKKLN EYAKEKVVDM HDLIDEVMTF QHLDYDKDPV VPTKPLKRYA  240
STGSLQKPDE TEKTFCSIDL DYILTKSQSM PLGSAIASGY PPELSSFQSS SYTPLSNDWL  300
LQCPSASVEQ QIIQSPESIS SQTTGLLGAS VHNSGILDDP TKSGRSFEIP IPMVYPMMHS  360
SSVFGNSEHE GCPITKIQAS NLSSGSDAVF NLGQCYPGVS FSDPGIPDTP LGASFYTAPP  420
EASFLNDTTP LEPSFLNDNL KDQSHLYLQG PKSLTDGGQW FDPCHKLDFP GP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-27551611106B-MYB
1h8a_C2e-275716123126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794390.0HF679439.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB33 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002438653.10.0hypothetical protein SORBIDRAFT_10g023665, partial
TrEMBLC5Z5P10.0C5Z5P1_SORBI; Putative uncharacterized protein Sb10g023665 (Fragment)
STRINGSb10g023665.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP129022331
Representative plantOGRP1067739
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26930.14e-53myb domain protein 97